PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626596.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 259aa    MW: 29980.1 Da    PI: 8.8787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626596.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v+++G g W+ ++ + g++R++k+c++rw++yl
   XP_009626596.1 14 KGAWTEEEDLLLRRCVEMYGEGKWHQVPIRAGLNRCRKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding431.1e-1367112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ +E +l+++++k+lG + W++Ia +++ gRt+ ++k++w+++l
   XP_009626596.1  67 RGDFSSDEIDLILRLHKLLGYR-WSLIAGRLP-GRTASDVKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-23964IPR009057Homeodomain-like
PROSITE profilePS5129425.345965IPR017930Myb domain
SuperFamilySSF466894.03E-2711108IPR009057Homeodomain-like
SMARTSM007172.8E-151363IPR001005SANT/Myb domain
PfamPF002497.6E-171461IPR001005SANT/Myb domain
CDDcd001671.77E-101661No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2165116IPR009057Homeodomain-like
PROSITE profilePS5129417.87666116IPR017930Myb domain
SMARTSM007172.3E-1366114IPR001005SANT/Myb domain
PfamPF002492.8E-1267112IPR001005SANT/Myb domain
CDDcd001679.12E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MNTTTITKSS GVRKGAWTEE EDLLLRRCVE MYGEGKWHQV PIRAGLNRCR KSCRLRWLNY  60
LRPHIKRGDF SSDEIDLILR LHKLLGYRWS LIAGRLPGRT ASDVKNYWNT HLQRKLIPPQ  120
RQDRKRRILK ITEKTTVRPR PRTFSSAKNV SLCSNRSIRK TIHKEEGNKE INICEKPTGD  180
APTDDGIQWW TSLLDNCNEI EETAAVVGSI NFEENNKLLS LLHEEISPPI NGESNCMQEG  240
QSGNWDNFSV DIDLWDLLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-20141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113125RKLIPPQRQDRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626596.10.0PREDICTED: transcription factor MYB90-like
SwissprotQ9FNV91e-60MY113_ARATH; Transcription factor MYB113
TrEMBLE9N6631e-121E9N663_PETHY; PURPLE HAZE
STRINGSolyc10g086250.1.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.16e-62myb domain protein 113